Free Word Search Generator & Maker

Free online word search generator and maker — no sign-up, unlimited, printable PDF.

My Word Search

VATPENCILFOAOMNLLGNIDAERAREYTYNVJQZHUPDPDRAOVCBYFIUHLOTTRIGCSRTNMTEKEASCWQSPMSASCGRNJJQTUICZEUHOVCQBBHHESTHSRVKVKQEBSPISMDACXKRPNHMEYCSCIENCEHUL
Find these words:
  • teacher
  • student
  • pencil
  • lesson
  • recess
  • science
  • history
  • reading

How to make a word search in three steps

A good word search takes about a minute to build. The tool above does the hard part — placing words at different angles and filling the empty squares — so you can focus on the vocabulary that matters for your lesson.

  1. Enter your words. Type one word per line in the box. These can be spelling words, science vocabulary, characters from a novel, Spanish verbs, historical figures — anything your class is studying that week.
  2. Set the difficulty. Choose a grid size and decide whether words can run backwards and diagonally. Bigger grids and more directions make the puzzle harder; a small grid with only forward words suits younger children.
  3. Print or save. Click Print / Save PDF to get a clean, ink-friendly sheet. Print one copy with the answer key ticked for yourself, and a set without it for students.

What makes a word search worth doing

Used well, a word search is more than a time-filler. Hunting for a word forces students to hold its exact spelling in mind and scan for it letter by letter, which quietly reinforces orthographic patterns — the reason spelling word searches help early readers more than they look like they should. Because the activity is self-checking and low-pressure, it is also one of the few tasks a whole mixed-ability class can start independently while you take attendance, meet with a small group, or settle the room after a transition.

The trick is to tie the words to something the class is actively learning. A random list of animals teaches little; the ten vocabulary terms from today's ecology unit turn the same puzzle into review. When the words carry meaning from the lesson, students re-encounter that vocabulary one more time, in a different format, which is exactly the kind of spaced repetition that helps terms stick.

Ways teachers use word searches in class

Making it harder or easier

Difficulty comes from three dials. The grid size sets how much empty space students must scan; a 20×20 grid is genuinely challenging even for adults. Allowing backwards and diagonal placement roughly doubles the directions a word can hide in, which is where most of the difficulty for older students comes from. Finally, the overlap of shared letters — which the generator creates automatically when words cross — adds a layer of visual noise that makes each word harder to pick out.

For differentiation, build two versions of the same vocabulary: a small forward-only grid for students who need support, and a large multi-direction grid for those ready for a challenge. Because the word list is identical, every student practices the same terms — only the search difficulty changes. That lets you hand the right sheet to the right student without anyone feeling singled out.

Printing, saving and reusing

The Print / Save PDF button opens your browser's print dialog. From there you can send the puzzle straight to a printer or choose “Save as PDF” to keep a digital copy — handy for posting to Google Classroom or emailing to families. Because the puzzle is drawn in black and white, it prints cleanly on any classroom printer without draining color ink.

If you want a different arrangement of the same words, click Shuffle to regenerate the grid. That gives you several unique puzzles from one word list — useful for making multiple versions so neighbors can't simply copy, or for building a small packet across a week.

Want ready-made puzzle packs?

Join the Chalkbox list for free seasonal word-search and puzzle packs, plus new classroom tools as they launch. No spam.

Word searches in Spanish and other languages

The generator accepts any word list you type, so building a puzzle in Spanish, French, German or another language that uses the Latin alphabet works the same way as English — type the words, choose a grid size, and print. There is one real limit worth knowing before you build a puzzle en español: the grid only places the letters A–Z, so accented characters like ñ, é, á, í, ó or ü are stripped out of a word before it goes on the grid. A word like "año" becomes "AO" once placed, which works for many vocabulary lists but changes the spelling wherever the accent matters.

Non-Latin scripts — Arabic, Hebrew, Chinese, Japanese, Korean, Greek, Tamil, Russian and similar alphabets — are not supported right now. Because the grid can only fill squares with A–Z, a word typed in one of these scripts is dropped from the puzzle rather than shown incorrectly. If you teach in one of these languages, the most reliable option today is to romanize the vocabulary into the Latin alphabet before you enter it — Pinyin for Mandarin or Hepburn romaji for Japanese, for example — so every letter places correctly. You can then pair the puzzle with a translation key on a separate handout for the native script and meaning.

Word search ideas by grade and subject

The same generator adapts to almost any age or subject just by changing the word list and the settings around it. A few starting points:

Customizing size and theme

Grid size is the main dial for how a puzzle looks and feels. Pick anything from 10×10 up to 20×20 from the size dropdown: a small grid with a short word list prints with large, easy-to-read letters — a workable stand-in for a "large-print" puzzle for younger students or anyone who needs bigger text — while a large grid with a full word list packs more into the same page.

There is no built-in shape option — puzzles are always a square or rectangular grid, not a heart, star or other outline — and there are no pre-built holiday templates. The way to make a themed puzzle today is through your word list: type Christmas vocabulary for a December bell-ringer, Halloween words for an October warm-up, or Valentine's Day terms for February, and the puzzle becomes seasonal without any extra settings to find.

Difficulty controls: backwards and diagonal words

Two settings control how hard a puzzle is. Grid size sets how much empty space students have to scan before they spot a word — bigger grids take longer regardless of anything else. Allow backwards & diagonal is a single toggle that controls whether words can run in reverse through the grid. With it off, words are restricted to mostly forward, left-to-right and top-to-bottom placements, which removes most of the guesswork for younger readers; with it on, words can also run backwards and in more directions, which is where most of the added difficulty for older students comes from. There is currently no separate control to allow diagonal placement while blocking backwards placement, or vice versa — it is one combined setting.

Hidden messages and clue-based puzzles

Some word search generators hide a bonus message in the leftover letters, or swap the word list for picture clues or riddles instead of plain words. The Chalkbox word search maker does not do either of those yet — every puzzle here is built from a plain list of words you type in, and the squares that are not part of a word are filled with random letters, not a hidden phrase. If a clue-based puzzle is what you are after right now, the crossword puzzle maker already works that way — you type word = clue and it builds a numbered grid from your clues instead of the plain words.

Answer keys and download formats

Tick Show answer key to highlight every hidden word on the grid, and print that version for yourself while the unticked version goes to students. The Print / Save PDF button opens your browser's normal print dialog, where you can send the puzzle straight to a printer or choose "Save as PDF" to keep a digital copy. There is no separate PNG, JPG or SVG export, and no built-in book-style bundler for stacking many puzzles into one file — for a small packet, click Shuffle to generate a new layout from the same words, then print and save each version as its own PDF.

If you already use Word or Canva, you can technically lay out a word search grid by hand in either one — typing letters into a table or text boxes — but there is no built-in word search generator in Microsoft Word, and Canva's puzzle templates are static designs you fill in yourself rather than an automatic word-placement tool. Chalkbox's generator does the placement, direction and filler-letter work for you, which is the part that takes the most time by hand. As for solving one: scan the grid in straight lines — across, down, and diagonally if the puzzle allows it — checking both forward and backward for each word on your list, and cross words off as you find them so you always know what is left to search for.

Beyond the word search

A word search pairs naturally with the other printable makers on Chalkbox. Build a crossword puzzle from the same terms for students who need a bigger challenge, turn the list into a bingo game for whole-class review, or generate matching vocabulary worksheets so the week's words appear in several formats. Rotating the same vocabulary through different activities is a simple, evidence-friendly way to move terms into long-term memory without writing new material each time.

Frequently asked questions

Is this word search maker really free?

Yes. Every puzzle you build here is free, with no account, no watermark and no limit on how many you make. You can print straight from your browser or save as a PDF at no cost.

How many words can I put in one puzzle?

As many as fit the grid. A 12×12 grid comfortably holds 10–15 words; larger grids (up to 20×20) hold more. If a word is longer than the grid width, increase the grid size and it will place automatically.

Can I include an answer key?

Yes. Tick “Show answer key” to highlight where every word is hidden, then print that version for yourself. Untick it before printing the student copy.

Can I make the puzzle easier for younger students?

Turn off “Allow backwards & diagonal” so words only run left-to-right and top-to-bottom, and use a smaller grid. That keeps the search manageable for early readers.

Will my words be saved anywhere?

No. Everything runs in your browser — your word list never leaves your device and nothing is stored on our servers.

Can students play it on a screen?

The puzzle is designed for printing, but it also displays cleanly on a projector or tablet if you want a whole-class version. For an interactive digital game, try our review-game tools instead.

Can I use or sell puzzles I make with this word search maker, for example in a book on Amazon KDP?

Yes, you can sell puzzle books or worksheet packets made with this tool. Grids are generated fresh in your browser from the words and settings you enter, and Chalkbox places no license, attribution requirement, or usage restriction on the finished file. Your word list must be your own work or public-domain vocabulary, because the tool builds the grid layout without granting rights to copyrighted material.

Can I share a puzzle with a link, or edit it after I generate it?

No, there is no shareable link or save-to-cloud feature, and each puzzle exists only in your browser until you print it or save it as a PDF. To send it to someone else, use "Print / Save PDF" and share that file. Grid placement is automatic with no manual mode to drag or reposition individual letters or words, but clicking "Shuffle" regenerates a new layout from the same word list.

Can I make a word search in another language, like Spanish, Arabic, or Hebrew?

This word search maker does not support non-Latin scripts like Arabic or Hebrew, and has no mode for accented characters. The grid places typed words as typed, but it fills all blank cells from a fixed English A to Z alphabet.

Can I make a word search in a shape, like a heart or a star?

No, this word search maker builds standard rectangular grids up to 20×20 only. It has no shaped-grid or custom-outline mode.

Chalkbox tools are provided free for classroom use. Puzzles are generated in your browser from the words you enter; always review the finished sheet before handing it to students.